Glass Cake

what should my green energy project be about?

I'm doing this project for science. The type of green energy is a real world example. I need to know where that energy comes from, how it is acquired, and how it is applied. Please help me.

In 1968,when I was in the eighth grade, I did a science project titled, Solar Desalination of Salt Water. It was pretty simple...a glass of salty water placed on a pie place covered by a glass cake dome. After a few hours in the sun the H2O had evaporated from the glass, condensed on the cake dome and was dripping into the pan. I then did drawings illustrating the large scale potential for such an set up purifying large quantities of water. Pretty simple, but possible. BTW: I won first place at the science fair. What do you think?

Find Glass Cake On eBay Below:

Green Depression Glass Anchor Hocking Ballerina Pattern Footed Cake Plate Stand
Green Depression Glass Anchor Hocking Ballerina Pattern Footed Cake Plate Stand
$14.99
VINTAGE GREEN DEPRESSION FOOTED CAKE PLATE 10 FLOWERS SUNFLOWER
VINTAGE GREEN DEPRESSION FOOTED CAKE PLATE 10 FLOWERS SUNFLOWER
$19.99
VTG ETCHED GLASS TURQUOISE CAKE PLATES BEAUTIFUL SET O 6
VTG ETCHED GLASS TURQUOISE CAKE PLATES BEAUTIFUL SET O 6
$12.00
Pyrex Pink 221 8 inch Round Pie Cake dish Pan Casserole
Pyrex Pink 221 8 inch Round Pie Cake dish Pan Casserole
$15.99
VINTAGE INDIANA TIARA SANDWICH GLASS PEDESTAL STAND 13 CAKE PLATE
VINTAGE INDIANA TIARA SANDWICH GLASS PEDESTAL STAND 13 CAKE PLATE
$30.00
Lovely Iridescent Tiffany Style Cake Display Stand Art Glass Artist Vandermark
Lovely Iridescent Tiffany Style Cake Display Stand Art Glass Artist Vandermark
$235.00
LADIES LUNCHEON GLASS ETCHED PLATE SET Berry Leaf 5 CRYSTAL DISHES DESERT CAKE
LADIES LUNCHEON GLASS ETCHED PLATE SET Berry Leaf 5 CRYSTAL DISHES DESERT CAKE
$6.50
VTG JEANETTE GLASS COGREEN DEPRESSION 10 FOOTED CAKE PLATE SWIRL PATTERN
VTG JEANETTE GLASS COGREEN DEPRESSION 10 FOOTED CAKE PLATE SWIRL PATTERN
$18.00
Antique Eapg Ripley 10 Cake Basket
Antique Eapg Ripley 10 Cake Basket
$45.00
VTG FEDERAL GLASS CO FOOTED CLEAR GLASS SUNFLOWER CAKE PLATTER PLATE SERVING
VTG FEDERAL GLASS CO FOOTED CLEAR GLASS SUNFLOWER CAKE PLATTER PLATE SERVING
$18.00
Fostoria CENTURY PRESSED Handled Cake Plate 145035
Fostoria CENTURY PRESSED Handled Cake Plate 145035
$29.99
Imperial 4 Pc Set Matching Cake Plate Relish Dish and Cream  Sugar
Imperial 4 Pc Set Matching Cake Plate Relish Dish and Cream Sugar
$25.00
Fire King Anchor Hocking Wheat 8 Inch Round Cake Pan Vintage New
Fire King Anchor Hocking Wheat 8 Inch Round Cake Pan Vintage New
$14.24
Vintage Clear Glass Cake Plate Platter Server Saw Tooth Edge Diamond Cut 12
Vintage Clear Glass Cake Plate Platter Server Saw Tooth Edge Diamond Cut 12
$22.50
Cake Plate Footed Roman Rosette Swirl Pressed Pattern Mid Century
Cake Plate Footed Roman Rosette Swirl Pressed Pattern Mid Century
$18.50
Vintage Glass Cake Fruit Dessert Serving Set Intaglio Grapes 5 piece
Vintage Glass Cake Fruit Dessert Serving Set Intaglio Grapes 5 piece
$34.99
IMPERIAL CRYSTAL CHRYSANTHEMUM SMOKE IRIDESCENT CAKE PLATE 10 3 8
IMPERIAL CRYSTAL CHRYSANTHEMUM SMOKE IRIDESCENT CAKE PLATE 10 3 8
$9.49
Large VTG Indiana Glass Co Square Milk Glass Pedestal Cake Server With Rumwell
Large VTG Indiana Glass Co Square Milk Glass Pedestal Cake Server With Rumwell
$44.00
TIFFANY  CO GLASS PEDESTAL CAKE PLATE
TIFFANY CO GLASS PEDESTAL CAKE PLATE
$20.00
Fostoria Coronet Cake Plate Torte Serving Platter w 7 serving plates Vintage USA
Fostoria Coronet Cake Plate Torte Serving Platter w 7 serving plates Vintage USA
$94.99
Lot of 4 pcs Pink Depression Jeanette Glass Buttons  Bows Cups Cake Plate
Lot of 4 pcs Pink Depression Jeanette Glass Buttons Bows Cups Cake Plate
$39.00
Vintage MIKASA Christmas Tree Crystal Glass Handle Cake Pie Server Austria
Vintage MIKASA Christmas Tree Crystal Glass Handle Cake Pie Server Austria
$15.99
Waterford Crystal Lismore Footed Cake Plate Pedestal Cake Stand 12
Waterford Crystal Lismore Footed Cake Plate Pedestal Cake Stand 12
$114.99
New Waterford Lismore 12 Inch Cake Plate
New Waterford Lismore 12 Inch Cake Plate
$131.47
New Waterford Modern Love Cake Knife  Server
New Waterford Modern Love Cake Knife Server
$47.06
CLEAR GLASS PEDESTAL CAKE PLATE
CLEAR GLASS PEDESTAL CAKE PLATE
$22.45
Anchor Hocking 2 Piece Tear Drop Cake Plate Set
Anchor Hocking 2 Piece Tear Drop Cake Plate Set
$53.41
Georges Briard Pedestal Glass Cake Stand Silverplated Edge Floral Center Design
Georges Briard Pedestal Glass Cake Stand Silverplated Edge Floral Center Design
$27.99
Vintage Green Tinted Clear Glass Cake Plate Decagon Shape Gold Edge Handles
Vintage Green Tinted Clear Glass Cake Plate Decagon Shape Gold Edge Handles
$19.79
Vintage Co Operative Flint EAPG Cake Stand with Lace Edge
Vintage Co Operative Flint EAPG Cake Stand with Lace Edge
$64.99
Vintage Glass Cake Stand Plate
Vintage Glass Cake Stand Plate
$19.99
Vintage Clear Etched Glass Cake Plate 11 inch Great Condition
Vintage Clear Etched Glass Cake Plate 11 inch Great Condition
$14.99
EAPG GOOD LUCK CLEAR HIGH STANDARD FTD CAKE STAND
EAPG GOOD LUCK CLEAR HIGH STANDARD FTD CAKE STAND
$122.99
Pink Miss America Depression Glass 3 Footed Cake Plate Hocking Glass 1935 1938
Pink Miss America Depression Glass 3 Footed Cake Plate Hocking Glass 1935 1938
$15.00
Antique Amber Gold Carnival Depression Glass Charger Server Cake Plate Pretty
Antique Amber Gold Carnival Depression Glass Charger Server Cake Plate Pretty
$20.00
2 FireKing Wheat pattern 8 Round Cake casarole Pans 1960s measure 2 deep 450
2 FireKing Wheat pattern 8 Round Cake casarole Pans 1960s measure 2 deep 450
$9.99
New Artland Simplicity Cake Stand 11 D 75 H W Gift Box
New Artland Simplicity Cake Stand 11 D 75 H W Gift Box
$46.99
EAPG INDIANA GLASS GARDEN PINK CAKE STAND C1913
EAPG INDIANA GLASS GARDEN PINK CAKE STAND C1913
$55.00
VINTAGE GREEN DEPRESSION GLASS Footed Cake Plate Jeannette Swirl Pattern 11 INCH
VINTAGE GREEN DEPRESSION GLASS Footed Cake Plate Jeannette Swirl Pattern 11 INCH
$34.99
VTG KROMEX Chrome  Glass Cake Server KAKOVER No 520 21 in Original Box USA Made
VTG KROMEX Chrome Glass Cake Server KAKOVER No 520 21 in Original Box USA Made
$22.49


Recently Purchased Glass Cake:


vintage anchor hocking clear miss america 12 footed cake plate, antique vintage anchor hocking dinner plate cake platter vegetable plate, 11 inverted thistle ruby red glass cake plate stand salver, pink depression glass mayfair open rose footed cake plate anchor hocking, vintage imperial glass candlewick clear cupped edge caketorte plate 11, tiffin green satin 2 handle cake plate, mikasa crystal cake platewith swans and frosted swan handles, vtgstunning black marbling pedestal square cake plate diamond cut bottom , artland candy cane round cake stand 6594486, vintage 11 footed cake plate of high quality lead cut crystal mint condtiion, pyrex brittney blue cake, fire king gay fad 9 round casserole cake pan 429 fruit, vintage anchor hocking milk glass low pedestal cake plate retro gold accent, fostoria crystal chintz etched large torte cake plate 14, mikasa satin rose cake plate by walther kristallglas, vintage anchor hocking blue sapphire bubble cake plates set of 8 vgc, fenton1960shugecake plate115handledleafmintprfvintagewhite milk glass, clear depression glass cake stand highlights of calla lilies of pink, depression green sun flower pattern cake plate, vtg arcoroc octime black amethsyt glass cake cake platter plate serving 13, irena crystal cake plate, cambridge decagon pink depression glass plate cake dish handled 12 serving, fenton hobnail milk glass pedestal cake stand 1212 ruffled edge, vintage green uranium jeannette glass sunflower 10 cake plate 3 footed glows, anchor hocking fire king summerfield flower colorful glass loaf pan cake dish , vintage crystoolite glass fruit amp; cake knife usa, fenton glassvintage1940stopazvaselineopalescentleafhandlecake platetray, waterford pink depression waffle cake plate whandles hocking glass co, vtg nos anchor hocking amber 8 square cake casserole oven microwave baking dish, vintage fire king anchor hocking biscayne round cakecasserole, 1930s pink depression cake platter, vintage westmoreland white paneled grape round pedestal glass cake plate stand, kig indonesia 10 light blue dinner cake plate embossed fruit, westmoreland vintage glass footed cake stand depression milk glass doric c1947, fenton milk glass spanish lace footed cake stand plate, thistle cake stand light amethyst glass bryce higbee or mosser cake plate, antique vintage green gilded depression glass flower art deco design cake plate, vintage durand crystal footed cake plate in box bridal wedding cristal darques, vtg clear glass pedestal cake stand plate harp base jeannette beaded edge, vintage fenton pink milk glass spanish lace pedestal compote cake fruit stand, federal glass pink depression sharon cabbage rose cake plate, set of 2 green vaseline uranium depression glass 105 dinner or cake plates, antique eapg clear glass pie saver cake plate stand flower chain scroll rare, vtg 1950s jeannette shell pink milk glass pedestal cake stand plate 10 perfect, pedestalled leaf motif etched glass serving plattercake stand 13, vintage clear glass footed scalloped lip edge 13 round cake plate platter vgc, amber glass 35 high cake plate caprice style pedestal scalloped edge golden , waterford crystal sullivan cake plate nib, american brilliant period cut glass tray or cake plate pairpoint murillo wow, 10 handeled cake plate, imperial glass ohio candlewick clear cake stand pedistal cake plate, jeannette glass cake stand harp gold trim scalloped ruffles pedestal plate clear, etched glass cake plate vintage heavy large serving platter, 3 pieces of mecbeth evans chiex classic 2 dinner 1 chopcake plates, vintage beaded edge cake sand on silvertone pedestal, beautiful vintage fostoria american clear glass handled cake plate platter, eapg lace edge no 44 cake stand cooperative flint glass, vintage 1930s green depression sunflower footed cake platestand jeanette mint, antique eapg mckee swirl amp; ball glass cake stand plate 7 tall, beautiful vintage rosella cake platter, pink american sweet heart depression glass 11 34 cake sandwich plate nice , vintage american cubist fostoria footed torte tidbit cake plate, rare antique vintage 10 green vaseline uranium glass cakecandyrelish plate, mckee glass isis cake stand 9 d eapg, brilliant glass dewdrop in points cake stand with rim 9 12 d eapg, victorian paneled cake stand 8 12 h eapg, duncan miller elegant sandwich cake stand 13 d, clear glass pedistal cake plate starburst leaf design, 12 clear glass cake plate starburst design, antique bryce higbee amp; co palm leaf fan pedestal cake dessert stand ca 1905, bryce glass rope bands cake stand 9 12 d eapg, vintage anchor hocking 6 by 10 glass baking dish cake pan, victorian blown cake stand 9 d eapg, elegant imperial cape cod cake stand 10 12 d, higbee glass beaded ellipse cake stand 9 12 deapg, impressive eapg cake stand pattern amp; maker unknown, corning ware p322 blue cornflower brownie cake pan baking dish 2 quart qt, vintage pyrex 2 milkglass cake pans handles vgc, vintage pattern clear glass cake serving plate wavy edges beaded fan handles, adams glass good luck horseshoe cake stand 8 d eapg, victorian flute variant cake stand 9 14 d, victorian cake stand 10 34 d eapg, higbee glass style madora cake stand 9 34 d eapg, pink three footed depression glass cake plate 10 inches sunflower, mosser pink milk glass crown tuscan pedestal cake plate 1225 inch, westmoreland cake plate stand paneled grape milk glass marked skirted, shannon crystal arabella clear footed food server elegant decor cake plate new, victorian circles and fans cake stand 9 12 d eapg, vintage jeannette pink glass cherry blossomhandled cake plate nice , dalzell gillmore and leighton glass priscilla cake stand 10 12 d eapg, paden city black forest green 210 lowfooted cake salver or cake plate, pink depression jeannette glass sunflower 3 footed 10 cake plate 1930s, vintage clear glass footed cake plate stand 12 14 ribbed starburst design , vintage waterford crystal handle cake knife boxed wedding 12, vintage waterford crystal handle cake knife boxed wedding 13 12, fostoria glass book cake stand punch bowl coin pitcher, honeycomb cake stand 9 12 d eapg



Comments are closed.