Huge Glass

'Huge Glass Comic Book' To Debut At Wizard World Mid-Ohio Comic Con, Oct. 22-23

Attendees at next weekend's Wizard World Mid-Ohio Comic Con will have the unique opportunity to check out the "Huge Glass Comic Book," the world's first glass comic book, blown up and lit up on glass. Each of its twelve pages is four feet high and three feet wide, all laser etched on quarter inch glass. The Huge Glass Comic Book is registered for three world record claims with Guinness World Records, including first glass comic book, largest glass comic book and largest comic book. At over 500 pounds of comic pages, it may also be the world's heaviest comic book.

The event, set for the Greater Columbus Convention Center, October 22-23, features stars James Marsters, Billy Dee Williams, Adam West, Burt Ward, Claudia Christian and Walter Koenig among dozens of celebrities and industry professionals celebrating the best in pop-fi, pop culture, movies, graphic novels, comics, toys, video gaming, television, sci-fi, gaming, original art, collectibles, contests and more.

The comic is a single concise story introducing Comangra City, a place where all the world's comic and cartoon genres live and interact with each other in a multi-cultural metropolis. Nearly every country has its own tradition of graphic story. It's time these traditions meet, mix and react with each other. Beyond the story, each page of the Huge Glass Comic Book highlights different graphic storytelling techniques in simple, reproducible ways. It took over 550 hours to create this comic and, four weeks into its completion, it's already attracting interest from galleries, educational institutions and even "Ripley's Believe It or Not! It's a one of a kind opportunity to see a first in comics and in art.

Wade Gugino, writer and creator of the Huge Glass Comic Book, will be present to page through the comic with fans and sell print versions of the comic and graphic story layout guide, as well as individual cards, prints and T-Shirts. This will be the very first public run of the print comic -- a limited edition sold out at ArtPrize 2011 in two weeks.

Mid-Ohio Comic Con is the eighth stop on Wizard World's 2011 North American tour. Hours are Saturday, October 22, 10 a.m. - 7 p.m.; and Sunday, October 23, 10 a.m. - 5 p.m. Tickets are available in advance online at http://www.wizardworld.com/midohio.html at a savings over tickets purchased at the door. Advance adult single-day tickets are priced at $25 ($35 on site); weekend all-session tickets are $40 ($50 on site), and tickets are free for children age 10 and under when accompanied by a paid adult (limit two children per adult). VIP packages with special entry and exclusive items are also available on a limited basis.

About Wizard World:

Wizard World produces Comic Cons and pop culture conventions across North America that celebrate graphic novels, comic books, movies, TV shows, gaming, technology, toys and social networking. The events often feature celebrities from movies and TV, artists and writers, and events such as premieres, gaming tournaments, panels, and costume contests. Wizard World also produces Wizard World Digital, an online publication covering new and upcoming products and talents in the pop culture world, and is distributed on a weekly basis to online and iPad users worldwide.

The full event schedule can be found at www.wizardworld.com.

***** SAVE THE 2011/12 DATES *****

October 22-23 – Mid-Ohio Comic Con

November 11-13 – Austin Comic Con

January 28-29, 2012 – New Orleans Comic Con

March 24-25, 2012 – Toronto Comic Con

May 19-20, 2012 – Big Apple Comic Con

June 1-3, 2012 – Philadelphia Comic Con

August 9-12, 2012 – Chicago Comic Con

Find Huge Glass On eBay Below:

Huge beautyCrystal SAMOBOR by Rogaska Footed Bowl Centerpiecewhoping 10lbRare
Huge beautyCrystal SAMOBOR by Rogaska Footed Bowl Centerpiecewhoping 10lbRare
$79.99
VTG Glass Paperweight Huge Stopper Pin Dish Handblown Lot of 2 Ribbon Swirl
VTG Glass Paperweight Huge Stopper Pin Dish Handblown Lot of 2 Ribbon Swirl
$9.99
Huge margarita trifle bowl clear ribbed glass dessert candy dish
Huge margarita trifle bowl clear ribbed glass dessert candy dish
$39.99
Antique Huge Glass SUGAR  CREAMER
Antique Huge Glass SUGAR CREAMER
$55.00
Huge Simon Pearce Crystal Handblown Art Studio Glass Center Table Bowl Signed
Huge Simon Pearce Crystal Handblown Art Studio Glass Center Table Bowl Signed
$39.99
AJKA MARSALA COBALT CASED CUT TO CLEAR CRYSTAL CENTERPIECE VASE HUGE
AJKA MARSALA COBALT CASED CUT TO CLEAR CRYSTAL CENTERPIECE VASE HUGE
$595.00
Huge SABINO French sculpture crystal opalescent signed FRANCE Dove Pigeon
Huge SABINO French sculpture crystal opalescent signed FRANCE Dove Pigeon
$560.00
HUGE Vintage JIM DAVIS Sulphide CHICKEN HEN Paperweight
HUGE Vintage JIM DAVIS Sulphide CHICKEN HEN Paperweight
$79.95
vtg mid century modern modernist otto brauer gul vase 20 huge label residue 60s
vtg mid century modern modernist otto brauer gul vase 20 huge label residue 60s
$259.99
VTG Pyrex Gold Paisley Blue Platter Oval HUGE Splatter NICE signed Paul Riche
VTG Pyrex Gold Paisley Blue Platter Oval HUGE Splatter NICE signed Paul Riche
$16.99
Vintage Huge Green Glass Boot Vase For Raymor 1950s 14Lbs 21 Tall
Vintage Huge Green Glass Boot Vase For Raymor 1950s 14Lbs 21 Tall
$139.99
HUGE AMBER WHITE  BROWN GLASS VASE WITH ORB WINDOWS 19 INCHES TALL
HUGE AMBER WHITE BROWN GLASS VASE WITH ORB WINDOWS 19 INCHES TALL
$35.00
HUGE 15 W AMETHYST GLASS BLENKO BOWL PLATE PLATTER
HUGE 15 W AMETHYST GLASS BLENKO BOWL PLATE PLATTER
$99.99
3 Huge 12oz HAND BLOWN Wine Glasses Clear with COBALT BLUE  GREEN SQUARES EX
3 Huge 12oz HAND BLOWN Wine Glasses Clear with COBALT BLUE GREEN SQUARES EX
$22.46
HUGE 31 inch LE SMITH RED ORANGE ART GLASS VASE mid century modern retro 50s
HUGE 31 inch LE SMITH RED ORANGE ART GLASS VASE mid century modern retro 50s
$39.99
RARE HUGE VINTAGE VENETIAN MURANO GLASS ELEPHANT c1940 50
RARE HUGE VINTAGE VENETIAN MURANO GLASS ELEPHANT c1940 50
$39.99
Large Punch Bowl Carnival Glass Crystal Huge Vintage Iridescent Art Deco EAPG
Large Punch Bowl Carnival Glass Crystal Huge Vintage Iridescent Art Deco EAPG
$166.32
FANTASTIC HUGE Crystal Glass 8Tx10W Bowl CAPTURES ALL COLORS OF RAINBOW WOW
FANTASTIC HUGE Crystal Glass 8Tx10W Bowl CAPTURES ALL COLORS OF RAINBOW WOW
$185.00
Set 4 Huge Clear HAND BLOWN IN MEXICO HURRICANE Glasses Goblets w Tags EX
Set 4 Huge Clear HAND BLOWN IN MEXICO HURRICANE Glasses Goblets w Tags EX
$29.96
HUGE ANTIQUE COUNTRY PRIMITIVE CHIC ENGLISH MOTTO WARE CUP  SAUCER
HUGE ANTIQUE COUNTRY PRIMITIVE CHIC ENGLISH MOTTO WARE CUP SAUCER
$4.99
CORELLE HUGE Lot 32 pieces Blue Hearts dishes plates bowls platters mugs
CORELLE HUGE Lot 32 pieces Blue Hearts dishes plates bowls platters mugs
$40.99
Heavy Huge Vintage Clear Diamond Cut Center Piece Vase 11 Tall Beautiful
Heavy Huge Vintage Clear Diamond Cut Center Piece Vase 11 Tall Beautiful
$11.00
TIFFANY  Co huge 12 woven vase SIGNED cylinder vase thick  heavy WOW
TIFFANY Co huge 12 woven vase SIGNED cylinder vase thick heavy WOW
$99.00
Vtg HUGE 1 QUART MEASURING 4 cup ANCHOR HOCKING 32oz MICROWAVEABLE grow room
Vtg HUGE 1 QUART MEASURING 4 cup ANCHOR HOCKING 32oz MICROWAVEABLE grow room
$3.95
LAST1 HUGE STAR Crystal Glass Platter FLOWERS  LEAVES GERMANY BEAUTIFUL
LAST1 HUGE STAR Crystal Glass Platter FLOWERS LEAVES GERMANY BEAUTIFUL
$115.00
HUGE CF MONROE WAVECREST HP ART GLASS LIDDED FOOTED BOX Ca LATE 1800S
HUGE CF MONROE WAVECREST HP ART GLASS LIDDED FOOTED BOX Ca LATE 1800S
$285.00
Stunning Huge Studio Art Glass Amber Paperweight Filled w huge Controlled
Stunning Huge Studio Art Glass Amber Paperweight Filled w huge Controlled
$25.00
A+ HUGE Wave Crest DRESSER BOX JAR Jewelry Casket RED POPPY FLOWER Collar Cuff
A+ HUGE Wave Crest DRESSER BOX JAR Jewelry Casket RED POPPY FLOWER Collar Cuff
$599.00
Huge Hand Blown Art Glass Ball Orb Ornament 12 Diameter In Outdoor USA Artist
Huge Hand Blown Art Glass Ball Orb Ornament 12 Diameter In Outdoor USA Artist
$239.99
HUGE ArT GLaSs VASE Artist VIC LEO Atlantis 6 Polychrome Mirror 11 Blue BARON
HUGE ArT GLaSs VASE Artist VIC LEO Atlantis 6 Polychrome Mirror 11 Blue BARON
$269.00
VINTAGE ART GLASS AMBER PITCHER RETRO MID CENTURY MODERN Huge Heavy 13 Swirl
VINTAGE ART GLASS AMBER PITCHER RETRO MID CENTURY MODERN Huge Heavy 13 Swirl
$89.99
Huge Lot of 58 Peter Rabbit Collectible TW Burgess Cup Plates Pairpoint
Huge Lot of 58 Peter Rabbit Collectible TW Burgess Cup Plates Pairpoint
$99.99
Vtg Jadeite Jadite Glass Mixing Serving Bowl Rolled Rim Lip 10 6 Quart HUGE
Vtg Jadeite Jadite Glass Mixing Serving Bowl Rolled Rim Lip 10 6 Quart HUGE
$135.00
FABULOUS HEAVY HUGE 16LONG HM Glass FISH Figurine MILLEFIORI Murano Italy
FABULOUS HEAVY HUGE 16LONG HM Glass FISH Figurine MILLEFIORI Murano Italy
$195.00
BOHEMIAN CZECH MOSER Cased Glass HUGE 3 PIECE SET Decanters Lidded Candy Dish
BOHEMIAN CZECH MOSER Cased Glass HUGE 3 PIECE SET Decanters Lidded Candy Dish
$899.95
Vtg 2 EAPG Depression Elegant Sandwich Glass Window Curtain Drape Tieback HUGE
Vtg 2 EAPG Depression Elegant Sandwich Glass Window Curtain Drape Tieback HUGE
$199.95
SHANNON IRELAND HUGE 12 TALL 24 LEAD CRYSTAL KINGS PEDESTAL BOWL
SHANNON IRELAND HUGE 12 TALL 24 LEAD CRYSTAL KINGS PEDESTAL BOWL
$55.00
Vintage Aqua Blue LE Smith Glass Moon  Stars Compote HUGE 95 X 7
Vintage Aqua Blue LE Smith Glass Moon Stars Compote HUGE 95 X 7
$59.00
enormous 28 inch antique vintage heavy cut glass decanter and huge stopper
enormous 28 inch antique vintage heavy cut glass decanter and huge stopper
$285.00
FENTONCARNIVAL GLASSXMINTYc1911ANTIQUECOBALT BLUESPEARHEADRIBHUGE 15VASE
FENTONCARNIVAL GLASSXMINTYc1911ANTIQUECOBALT BLUESPEARHEADRIBHUGE 15VASE
$229.00


Recently Purchased Huge Glass:


cranberry glass huge presentation goblet air filled stem 9 tall, huge westmoreland white milk glass pedestal bowl with handles 11, cristal darques huge lead crystal vase 11 34 vintage nice france arc 62510, confetti wheaton arts 2010 paperweight wild string lattice huge 5 tall, huge 8 pc place setting jadeite fireking restaurant ware jadite rare pieces, huge vintage 11 tall green hobnail gobletglass kings glass, huge 31cm tall very early bullicante lamp base 1950s white immersed in clear, superb murano huge glass sweets all perfect 16cm long x5 very tactile, early huge 23cm seguso aventurine vase silver inclusion carnival glass cased , 21 huge morano hand blown glass bowlmade in italyblack and whitenwt, murano swan bowl cotton candy green swirl italian blown glass huge swan dish, beautiful huge vtg studio cased art glass blown vase 12 12, viking huge 1125 ruby red glass footed centerpiecevase $pecial5 days only, rare rainbow art glass ruby red wjonquil rigaree crackle huge vase evc 12 tall, cofrac art verrier france huge 24 crystal clear chalet art glass vasebowl, huge tiffany amp; co glass oval paperweight with bicyclists gc 7lb, rare huge 1987 gibson paperweight weighs 7 pounds, huge lot 46 pieces of vintage art glass crackle tangerine red amberina green blu, huge vintage 18 12 inch italian venetian glass murano clown decanter exc, exquisite red daisy and button with flower panels huge vase in mint condition, hand blown murano jack in the pulpit tall art glass vase beautiful huge 14 12 , huge italian gold gilt glass bowl and charger 15 and 13 12 diameter, huge bohemianczech cranberrygold cut to clear glass decanter wprism stopper, fenton1950shugecake plate115handledleafmintperfvintagepink milk glass, heisey orchid etched huge 12 round crimped serving bowl with tag, french crystal beautiful plum and white huge vase so romantic elegant make offer, huge vtg blenko spiral floor vase 14 tall x 7 across sticker perfect estate, fenton glassvintagemintprf40srosepinkcresthuge 85melonvasea$4 shp sp, huge mid century l e smith viking green glass ribbed stretch swung vase avocado , huge saint st louis france camaret crystal vase 13 34 tall, vtg egermann ruby red bohemian intaglio cut to clear huge brandy style glass 8, denmark austrian crystal fruit apple pear huge 6 lbs, huge signed chalet cranberry art glass vasecenterpiece , huge vintage blenko figural flower sunflower daisy bowl 1525, huge museum quailty antique italian murano glass vase, fenton top hat vase french opalescent spiral optic swirl 1938 huge 6 x 9, blenko decanter 6954 myers guitarlike optic ribbed floor decanter huge 28 mint, vintage venetian murano glass clown figurine huge bowtie whimsical 8 34, art glass bowl white and burnt orange huge hand made, rare huge vintage western cowboy riding a stagecoach stain glass must see, formia murano mcm 1980 huge art glass face mask clown sculpture extraordinary, huge purple slag satin glass french bulldog pug doorstop westmoreland mold mint, vintage 1970s huge lot of 31 avon cape cod 1876 many new in box collectresell, purple slag carnival glass huge french bulldog doorstop westmoreland mold, fenton glassvintage70srosepinksatinhuge115melonvasexlnta $4 ship sp, corelle gold butterfly huge lotserving piecescasserolesextras plattersbowls, huge angloirish cutglass sweet meat 2 tier stand early 19thc hand blown, 2 huge makora krosno hand made designer art glass original poland 20 milk red, huge makora krosno hand made designer art glass made in poland 13 red swirl, fabulous and huge antique american frit flag amp; white eagle art glass paperweight, pair of huge clear glass goblets each holds a quart , huge ventri dart sculpture vase somerso 31cm tall superb item rare, superb murano huge crackle glass vase great condition 40cm tall, huge seguso aventurine tazza with gold inclusion cranberry cased 185cm tall, blown clear gleass red green and cobalt huge egg shaped paperweight, huge waterford crystal artisan 10 footed compote , 2 huge art glass horses by pino signoretto signed, huge art glass center bowlmuranoiridized glassstunning bowl, set of 2 huge iced tea drinking tumblers 7 tall 4 across, huge michael harris azurene fish vase isle of wight glass signed numbererd, vintage murano color glass italy bowl vase gold sparkle vintage huge, dazzling and huge antique american initials hjd frit art glass paperweight, outstanding amp; huge pink bimbah sulphide elephant art glass paperweight 1982 , huge mosser grapes amethyst glass pitcher holds 92 ounces applied handle, huge murano art glass fish signed and labelled limited edition 11, kristaluxus lead crystal glass owl sculpture riekes midcentury modern huge heavy, huge murano art glass bowl 155 diameter made in italy, fenton glassmintprfvintage50stopazvaselineopalescent hobnailhuge17vase, huge lot 48 vintage milk glass mugs federal glasbake galaxy corning, beautiful huge mont joye enameled twisted art glass vase cranberry enameled, huge golden murano flower vase, huge vintage art glass palm tree paperweight 3 516 diameter, huge fenton white milk glass basket applied handle hobnail ruffle edge sticker, huge 15 gold aventurine man gentleman figure figurine art glass sculpture wow, riedel wine glasses pairhuge rare , rare huge 18 meriden american brilliant alhambra greek key cut glass vase as is, 1950s huge fostoria crystal clear glass chanticleer rooster figure figurine 262, large art glass petal bowl aqua blue huge 11 x 5 , mint huge 18 hand blown glass terrariumgoldfishplantsbeadswinestunningwa , huge viking glass amberina lidded candy dish, huge murano lady figurine pink gold 13 tall vintage 60s my personal collection, vintage american art pottery huge tree trunk vase iridescent finish 175 inch, huge princess house pavillion white soup cereal coffee mug 24 oz, huge wicked old vintage christmas tree akro agate marble cullet rare 105 lbs, huge vintage amber glass lamp 34 inch tall works good no shade, unique 275 tall huge crystal bartop decanter hand cut pinwheel , rare amp; dramatic french art deco huge sabino gray glass vase signed, large wine glass decorative huge, huge waterford heritage crystal boat bowl 13 14 wide, beautiful huge ruby red glass 18 14 round serving bowl mint, shannon crystal godinger cobalt blue huge 10 x 5 12 ruffled bowl poland, fenton dave fetty huge stunning ruby mosaic hat 10 12, mid century vintage blenko styled amber mouth blown fish murano glass huge, huge 36 pc lot pyrex hocking pink green gooseberry sherbets dessert platesmint, huge 22 12 fostoria heirloom pink opalescent art glass vase antique vintage, huge uranium custard glass rock slag cullet 1188 pounds blacklight reactive , huge antique chalet gold art glass table centerpiece tendrils elegant



Comments are closed.